Olfr872 Peptide - middle region
Olfr872 Peptide - middle region
Product Specifications
Product Name Alternative
MOR145-3
UniProt
Q8VFI9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Olfr872 Rabbit Polyclonal Antibody (orb326643) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_666771
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RIPTKDGKYKAFSTCGSHLSVVCLFYGTSIGVYIGSTASNSPKNCAIASL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal Serpin B3/SCCA1 Antibody (OTI3C2) [DyLight 680]](https://cdn.genprice.uk/genprice/uk/genprice3.webp)
NBP2-74108FR 0.1 mL
Mouse Monoclonal Serpin B3/SCCA1 Antibody (OTI3C2) [DyLight 680]
Sign In for Pricing
View Details 
sc-337423 100 mg
8-chloro-2- (4-propylphenyl) quinoline-4-carbonyl chloride
Sign In for Pricing
View Details abx309800-01 20 µg
GRIP And Coiled-Coil Domain Containing 1 (GCC1) Antibody (HRP)
Sign In for Pricing
View Details abx309800-02 50 µg
GRIP And Coiled-Coil Domain Containing 1 (GCC1) Antibody (HRP)
Sign In for Pricing
View Details abx309800-03 100 µg
GRIP And Coiled-Coil Domain Containing 1 (GCC1) Antibody (HRP)
Sign In for Pricing
View Details abx309800-04 200 µg
GRIP And Coiled-Coil Domain Containing 1 (GCC1) Antibody (HRP)
Sign In for Pricing
View Details