Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Olfr872 Peptide - middle region

Olfr872 Peptide - middle region

Product Specifications

Product Name Alternative

MOR145-3

UniProt

Q8VFI9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Olfr872 Rabbit Polyclonal Antibody (orb326643) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_666771

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RIPTKDGKYKAFSTCGSHLSVVCLFYGTSIGVYIGSTASNSPKNCAIASL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POMT1 siRNA (h)
sc-61379 10 µM

POMT1 siRNA (h)

Sign In for Pricing
View Details
Mouse Anti-Human Ig lambda chain - Alexa Fluor 647
DL87481A-01 100 µL

Mouse Anti-Human Ig lambda chain - Alexa Fluor 647

Sign In for Pricing
View Details
Mouse Anti-Human Ig lambda chain - Alexa Fluor 647
DL87481A-02 500 µL

Mouse Anti-Human Ig lambda chain - Alexa Fluor 647

Sign In for Pricing
View Details
Mouse Anti-Human Ig lambda chain - Alexa Fluor 647
DL87481A-03 1 mL

Mouse Anti-Human Ig lambda chain - Alexa Fluor 647

Sign In for Pricing
View Details
Rat Arachidonate 12 lipoxygenase, 12R type (ALOX12B) ELISA kit
GTR10469494 96 Well

Rat Arachidonate 12 lipoxygenase, 12R type (ALOX12B) ELISA kit

Sign In for Pricing
View Details
MGC94207 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6250402 1.0 µg DNA

MGC94207 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details