Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ccdc59 Peptide - C-terminal region

Ccdc59 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2300004H16Rik, D10Ertd718e

UniProt

Q8R2N0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ccdc59 Rabbit Polyclonal Antibody (orb326662) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079878

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KRAAKKFEFEMRKQEREEAQRLYKKKKMEAFKILSKKTKKGQPNLNLQME

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHGDH Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9C2]
TA806876AM 100 µL

PHGDH Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9C2]

Sign In for Pricing
View Details
Nestin Recombinant Rabbit Monoclonal Antibody [SN06-27]
ET1611-21 100 µL

Nestin Recombinant Rabbit Monoclonal Antibody [SN06-27]

Sign In for Pricing
View Details
BMP1 Human Gene Knockout Kit (CRISPR)
KN212538BN 1 Kit

BMP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PDE6D (NM_002601) Human Over-expression Lysate
LY419219 100 µg

PDE6D (NM_002601) Human Over-expression Lysate

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/3193), CF568 conjugate, 0.1mg/mL
BNC683193-500 1x 500 µL

Prohibitin (Mitochondrial Marker) (PHB/3193), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human VEGF-C, C-His, Flag Tag
HA210869-01 20 µg

Human VEGF-C, C-His, Flag Tag

Sign In for Pricing
View Details