Ccdc59 Peptide - C-terminal region
Ccdc59 Peptide - C-terminal region
Product Specifications
Product Name Alternative
2300004H16Rik, D10Ertd718e
UniProt
Q8R2N0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ccdc59 Rabbit Polyclonal Antibody (orb326662) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_079878
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KRAAKKFEFEMRKQEREEAQRLYKKKKMEAFKILSKKTKKGQPNLNLQME
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC882592-500 1x 500 µL
Aldo-keto Reductase Family 1 Member B1 (Adrenal Marker) (CPTC-AKR1B1-2), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
