Cyp4f17 Peptide - middle region
Cyp4f17 Peptide - middle region
Product Specifications
Product Name Alternative
EG208285
UniProt
Q9EP75
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Cyp4f17 Rabbit Polyclonal Antibody (orb326667) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001094915
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VLLLAKDEHGKELSDEDIRAEADTFMFGGHDTTASALSWILYNLARHPEY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K3500104 1.0 µg DNA
AI467606 sgRNA CRISPR Lentivector (Mouse) (Target 3)
Sign In for Pricing
View Details MBS7072266 Inquire
Recombinant Shewanella sp. Glycerol-3-phosphate acyltransferase (plsY), partial
Sign In for Pricing
View Details 
MBS9351792 Inquire
Duck Inactive N-Acetylated-Alpha-Linked Acidic Dipeptidase-Like Protein 2 (NAALADL2) ELISA Kit
Sign In for Pricing
View Details