Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyp4f17 Peptide - middle region

Cyp4f17 Peptide - middle region

Product Specifications

Product Name Alternative

EG208285

UniProt

Q9EP75

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cyp4f17 Rabbit Polyclonal Antibody (orb326667) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001094915

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VLLLAKDEHGKELSDEDIRAEADTFMFGGHDTTASALSWILYNLARHPEY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fam180a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3692606 1.0 µg DNA

Fam180a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
PLXNA2 Antibody
DF9760-01 100 µL

PLXNA2 Antibody

Sign In for Pricing
View Details
PLXNA2 Antibody
DF9760-02 200 µL

PLXNA2 Antibody

Sign In for Pricing
View Details
Human CCR5 MAb (Clone 45502)
MAB180-100 100 µg

Human CCR5 MAb (Clone 45502)

Sign In for Pricing
View Details
(5,5-Dimethyltetrahydrofuran-2-yl) methanamine
OR1035985-01 100 mg

(5,5-Dimethyltetrahydrofuran-2-yl) methanamine

Sign In for Pricing
View Details
(5,5-Dimethyltetrahydrofuran-2-yl) methanamine
OR1035985-02 250 mg

(5,5-Dimethyltetrahydrofuran-2-yl) methanamine

Sign In for Pricing
View Details