Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fbxo47 Peptide - C-terminal region

Fbxo47 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2900052P03Rik, Gm1562

UniProt

A2A6H3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fbxo47 Rabbit Polyclonal Antibody (orb586828) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001074904

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FACVTMEMLQPVMSGDRDDDDRGFLNLFHLLHAQANFHKEVLYLTMNAIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm10487 (NM_001100609) Mouse Tagged Lenti ORF Clone
MR212290L4 10 µg

Gm10487 (NM_001100609) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rfx1 3'UTR GFP Stable Cell Line
TU267511 1.0 mL

Rfx1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PEAV/SADS-CoV/SeA-CoV Spike Recombinant Protein (N-His)
VK585012-01 50 µg

PEAV/SADS-CoV/SeA-CoV Spike Recombinant Protein (N-His)

Sign In for Pricing
View Details
PEAV/SADS-CoV/SeA-CoV Spike Recombinant Protein (N-His)
VK585012-02 100 µg

PEAV/SADS-CoV/SeA-CoV Spike Recombinant Protein (N-His)

Sign In for Pricing
View Details
PEAV/SADS-CoV/SeA-CoV Spike Recombinant Protein (N-His)
VK585012-03 1 mg

PEAV/SADS-CoV/SeA-CoV Spike Recombinant Protein (N-His)

Sign In for Pricing
View Details
MEK6 Rabbit pAb
E45R20741N 50 ul

MEK6 Rabbit pAb

Sign In for Pricing
View Details