Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fbxo47 Peptide - C-terminal region

Fbxo47 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2900052P03Rik, Gm1562

UniProt

A2A6H3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fbxo47 Rabbit Polyclonal Antibody (orb586828) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001074904

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FACVTMEMLQPVMSGDRDDDDRGFLNLFHLLHAQANFHKEVLYLTMNAIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UXS 1 (UXS1) (NM_025076) Human Tagged ORF Clone Lentiviral Particle
RC203354L3V 200 µL

UXS 1 (UXS1) (NM_025076) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Hsa-miR-7843-3p miRNA Mimic
CMH2506-01 5 nmol

Hsa-miR-7843-3p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-7843-3p miRNA Mimic
CMH2506-02 10 nmol

Hsa-miR-7843-3p miRNA Mimic

Sign In for Pricing
View Details
ZAP70 antibody
70R-10263 100 µL

ZAP70 antibody

Sign In for Pricing
View Details
Human Intelectin 2 (ITLN2) ELISA Kit
RDR-ITLN2-Hu-96Tests 96 Tests

Human Intelectin 2 (ITLN2) ELISA Kit

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Protein lin-15A (lin-15A), partial
MBS1448278 Inquire

Recombinant Caenorhabditis elegans Protein lin-15A (lin-15A), partial

Sign In for Pricing
View Details