Lmtk3 Peptide - middle region
Lmtk3 Peptide - middle region
Product Specifications
Product Name Alternative
BC059845, aatyk3
UniProt
Q5XJV6
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Lmtk3 Rabbit Polyclonal Antibody (orb586847) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001005511
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RGLLKSPRAADEPEDSELERKRKMVSFHGDVTVYLFDQETPTNELSVQGT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC742467-100 1x 100 µL
Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2467), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
AP20960PU-N 100 µg
NMDAR1 (GRIN1) pSer896 Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
![TIGIT Mouse Monoclonal Antibody [Clone ID: OTI8A12]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908e79/imageurl/cf813030.webp)
CF813030 100 µg
TIGIT Mouse Monoclonal Antibody [Clone ID: OTI8A12]
Sign In for Pricing
View Details