Lmtk3 Peptide - middle region
Lmtk3 Peptide - middle region
Product Specifications
Product Name Alternative
BC059845, aatyk3
UniProt
Q5XJV6
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Lmtk3 Rabbit Polyclonal Antibody (orb586847) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001005511
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RGLLKSPRAADEPEDSELERKRKMVSFHGDVTVYLFDQETPTNELSVQGT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC401297 20 µg
Proteinase Activated Receptor 4 (F2RL3) (NM_003950) Human Over-expression Lysate
Sign In for Pricing
View Details 
