Taco1 Peptide - middle region
Taco1 Peptide - middle region
Product Specifications
Product Name Alternative
Ccdc44, RGD1306784
UniProt
B2RYT9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Taco1 Rabbit Polyclonal Antibody (orb586899) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001101772
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AVAFAGHNKWSKVRHIKGPKDMERSRIFSKLTLSIRLAVKEGGPNPENNS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470968-500 1x 500 µL
CD63 (LAMP3/968), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
AP17652PU-N 400 µL
Plzf (ZBTB16) (C-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details ![MET Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E6]](https://cdn.genprice.uk/products/937/68dd1b7c061270361ea1cc08/imageurl/ta805795am.webp)
TA805795AM 100 µL
MET Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E6]
Sign In for Pricing
View Details