Taco1 Peptide - middle region
Taco1 Peptide - middle region
Product Specifications
Product Name Alternative
Ccdc44, RGD1306784
UniProt
B2RYT9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Taco1 Rabbit Polyclonal Antibody (orb586899) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001101772
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AVAFAGHNKWSKVRHIKGPKDMERSRIFSKLTLSIRLAVKEGGPNPENNS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Plasma Cell Mouse Monoclonal Antibody [Clone ID: SPM310]](https://cdn.genprice.uk/products/937/68dd189e061270361e8fd4e3/imageurl/am33283pu-s.webp)
AM33283PU-S 100 µg
Plasma Cell Mouse Monoclonal Antibody [Clone ID: SPM310]
Sign In for Pricing
View Details 
TP310159M 100 µg
Beta crystallin S (CRYGS) (NM_017541) Human Recombinant Protein
Sign In for Pricing
View Details 
LY402915 100 µg
ETL (ADGRL4) (NM_022159) Human Over-expression Lysate
Sign In for Pricing
View Details