Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tbc1d23 Peptide - C-terminal region

Tbc1d23 Peptide - C-terminal region

Product Specifications

Product Name Alternative

4930451A13Rik, AU015720, AU043671, AU043778, D030022P07Rik, W51689

UniProt

Q8K0F1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tbc1d23 Rabbit Polyclonal Antibody (orb326689) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080530

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKKKHPELITFKYGNSSASGIEILAIERYLIPNAGDATRAIKQQIMKVLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSLP Antibody
24487 100 µL

TSLP Antibody

Sign In for Pricing
View Details
CUX1 Antibody
A18568-100UL 100 µL

CUX1 Antibody

Sign In for Pricing
View Details
PAR4 Polyclonal Antibody, HRP Conjugated
bs-1196R-HRP 100 µL

PAR4 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
CD11b activation epitope Antibody
abx140366 0.1 mg

CD11b activation epitope Antibody

Sign In for Pricing
View Details
Ldb3 (NM_001039076) Mouse Recombinant Protein
TP519046 20 µg

Ldb3 (NM_001039076) Mouse Recombinant Protein

Sign In for Pricing
View Details
AKR1B1 Peptide-middle region
MBS3249433-01 0.1 mg

AKR1B1 Peptide-middle region

Sign In for Pricing
View Details