Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tbc1d23 Peptide - C-terminal region

Tbc1d23 Peptide - C-terminal region

Product Specifications

Product Name Alternative

4930451A13Rik, AU015720, AU043671, AU043778, D030022P07Rik, W51689

UniProt

Q8K0F1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tbc1d23 Rabbit Polyclonal Antibody (orb326689) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080530

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKKKHPELITFKYGNSSASGIEILAIERYLIPNAGDATRAIKQQIMKVLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMBRD1 Human Pre-designed siRNA Set A
HY-RS07708 1 Set

LMBRD1 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-VPS26B Antibody
A12325-1 100 µL

Anti-VPS26B Antibody

Sign In for Pricing
View Details
Lentiviral mouse Gtsf1l shRNA (UAS) - Lentiviral mouse Gtsf1l shRNA (UAS, RFP) (100)
GTR15135900 1 Vial

Lentiviral mouse Gtsf1l shRNA (UAS) - Lentiviral mouse Gtsf1l shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
CDHR1 CRISPR Knock Out 293T Cell Line (Human)
15676141 1x 10^6 Cells / 1.0 mL

CDHR1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Dyt1 ORF Vector (Rat) (pORF)
ORF066309 1.0 µg DNA

Dyt1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
IL-3 Polyclonal Antibody, PE-Cy7 Conjugated
bs-2598R-PE-Cy7 100 µL

IL-3 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details