Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wfikkn2 Peptide - C-terminal region

Wfikkn2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RGD1305361

UniProt

D3Z9K5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Wfikkn2 Rabbit Polyclonal Antibody (orb326697) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_220855

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLIIMGEVEGGMAMLKPDSFVGASSTRRVRKLREVMYKKTCDVLKDFLGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Perilipin 1 (PLIN1) ELISA Kit
MBS2019790-01 24 Strip Well

Mouse Perilipin 1 (PLIN1) ELISA Kit

Sign In for Pricing
View Details
Mouse Perilipin 1 (PLIN1) ELISA Kit
MBS2019790-02 48 Well

Mouse Perilipin 1 (PLIN1) ELISA Kit

Sign In for Pricing
View Details
Mouse Perilipin 1 (PLIN1) ELISA Kit
MBS2019790-03 96 Well

Mouse Perilipin 1 (PLIN1) ELISA Kit

Sign In for Pricing
View Details
Mouse Perilipin 1 (PLIN1) ELISA Kit
MBS2019790-04 5x 96 Well

Mouse Perilipin 1 (PLIN1) ELISA Kit

Sign In for Pricing
View Details
Mouse Perilipin 1 (PLIN1) ELISA Kit
MBS2019790-05 10x 96 Well

Mouse Perilipin 1 (PLIN1) ELISA Kit

Sign In for Pricing
View Details
Bovine Centromere protein L, CENPL ELISA KIT
ELI-34205b 96 Tests

Bovine Centromere protein L, CENPL ELISA KIT

Sign In for Pricing
View Details