Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wfikkn2 Peptide - C-terminal region

Wfikkn2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RGD1305361

UniProt

D3Z9K5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Wfikkn2 Rabbit Polyclonal Antibody (orb326697) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_220855

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLIIMGEVEGGMAMLKPDSFVGASSTRRVRKLREVMYKKTCDVLKDFLGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MyBlock l- digital dry bath single chamber without blocks 230V
BLO1260 1 Each

MyBlock l- digital dry bath single chamber without blocks 230V

Sign In for Pricing
View Details
Anti-Human CD110/MPL Antibody (VB22B), APC
FHE26213 100 Tests

Anti-Human CD110/MPL Antibody (VB22B), APC

Sign In for Pricing
View Details
IQGAP3 Rabbit pAb
E45R28179N-100 100 µL

IQGAP3 Rabbit pAb

Sign In for Pricing
View Details
Mouse Tceal1 qPCR Primer Pair
QM61606S 200 Tests

Mouse Tceal1 qPCR Primer Pair

Sign In for Pricing
View Details
Adrbk1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6866906 1.0 µg DNA

Adrbk1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Golga2 (NM_001080968) Mouse Tagged ORF Clone
MR224240 10 µg

Golga2 (NM_001080968) Mouse Tagged ORF Clone

Sign In for Pricing
View Details