Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A2ld1 Peptide - C-terminal region

A2ld1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GGACT, A2ld1

UniProt

Q923B0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with A2ld1 Rabbit Polyclonal Antibody (orb586917) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_663441

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WEGDGDPGDSVQCFVYTTATYAPEWLFLPYHESYDSEGPHGLRYNPRENR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD11c Antibody (ITGAX/1243) [Alexa Fluor 350]
NBP2-54432AF350 0.1 mL

Mouse Monoclonal CD11c Antibody (ITGAX/1243) [Alexa Fluor 350]

Sign In for Pricing
View Details
Acot7 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6894003 1.0 µg DNA

Acot7 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
ETFDH Antibody
orb39734-01 50 μL

ETFDH Antibody

Sign In for Pricing
View Details
ETFDH Antibody
orb39734-02 100 µL

ETFDH Antibody

Sign In for Pricing
View Details
HTRA4 Protein
MBS517059-01 0.02 mg

HTRA4 Protein

Sign In for Pricing
View Details
HTRA4 Protein
MBS517059-02 0.1 mg

HTRA4 Protein

Sign In for Pricing
View Details