Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A2ld1 Peptide - C-terminal region

A2ld1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GGACT, A2ld1

UniProt

Q923B0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with A2ld1 Rabbit Polyclonal Antibody (orb586917) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_663441

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WEGDGDPGDSVQCFVYTTATYAPEWLFLPYHESYDSEGPHGLRYNPRENR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Rab11fip1 shRNA (UAS) - Lentiviral mouse Rab11fip1 shRNA (UAS) (25)
GTR15289529 1 Vial

Lentiviral mouse Rab11fip1 shRNA (UAS) - Lentiviral mouse Rab11fip1 shRNA (UAS) (25)

Sign In for Pricing
View Details
GDF2 Antibody, Biotin conjugated
MBS1496231-01 0.05 mg

GDF2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
GDF2 Antibody, Biotin conjugated
MBS1496231-02 0.1 mg

GDF2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
GDF2 Antibody, Biotin conjugated
MBS1496231-03 5x 0.1 mg

GDF2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Serum Kalium Microplate Assay Kit
ASK1104 100 Assays

Serum Kalium Microplate Assay Kit

Sign In for Pricing
View Details
MAMSTR, NT (MAMSTR, MASTR, MEF2-activating motif and SAP domain-containing transcriptional regulator, MEF2-activating SAP transcriptional regulatory protein) (MaxLight 550)
MBS6318150-01 0.1 mL

MAMSTR, NT (MAMSTR, MASTR, MEF2-activating motif and SAP domain-containing transcriptional regulator, MEF2-activating SAP transcriptional regulatory protein) (MaxLight 550)

Sign In for Pricing
View Details