1110021J02Rik Peptide - middle region
1110021J02Rik Peptide - middle region
Product Specifications
Product Name Alternative
Ccdc167, 1110021J02Rik
UniProt
Q9D162
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ccdc167 Rabbit Polyclonal Antibody (orb326711) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001157213
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MTKKKRENLGVAQEIDGLEEKLSRCRKDLEAVTSQLYRAELSPEDRRSLE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![KLKB1 Recombinant Rabbit Monoclonal Antibody [JE31-29]](https://cdn.genprice.uk/products/992/68dd1c90061270361ea82bdd/imageurl/ha721397.webp)
HA721397 100 µL
KLKB1 Recombinant Rabbit Monoclonal Antibody [JE31-29]
Sign In for Pricing
View Details 
#31068-T 1 Kit
AccuGreenTM High Sensitivity dsDNA Quantitation Solution (100 assays)
Sign In for Pricing
View Details 
