1110021J02Rik Peptide - middle region
1110021J02Rik Peptide - middle region
Product Specifications
Product Name Alternative
Ccdc167, 1110021J02Rik
UniProt
Q9D162
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ccdc167 Rabbit Polyclonal Antibody (orb326711) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001157213
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MTKKKRENLGVAQEIDGLEEKLSRCRKDLEAVTSQLYRAELSPEDRRSLE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![EPM2A Mouse Monoclonal Antibody [Clone ID: k2A3]](https://cdn.genprice.uk/products/937/68dd189b061270361e8fc3bc/imageurl/am09050pu-n.webp)
AM09050PU-N 100 µL
EPM2A Mouse Monoclonal Antibody [Clone ID: k2A3]
Sign In for Pricing
View Details 
LC429085 20 µg
Decorin (DCN) (NM_001920) Human Over-expression Lysate
Sign In for Pricing
View Details 
