Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calml4 Peptide - N-terminal region

Calml4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2010002G05Rik

UniProt

Q91WQ9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Calml4 Rabbit Polyclonal Antibody (orb586952) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612177

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YKECFSLYDKQQRGKIKATDLLVSMRCLGASPTPGEVQRHLQTHGIDKNG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJC2 (Center) Rabbit Polyclonal Antibody
AP51292PU-N 400 µL

DNAJC2 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
acyl CoA Thioesterase 2 (ACOT2) Human Gene Knockout Kit (CRISPR)
KN402837 1 Kit

acyl CoA Thioesterase 2 (ACOT2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LELP1 (NM_001010857) Human Over-expression Lysate
LY423187 100 µg

LELP1 (NM_001010857) Human Over-expression Lysate

Sign In for Pricing
View Details
Dibenzylamine
TRC-D417505-1G 1 g

Dibenzylamine

Sign In for Pricing
View Details
N-Benzylcyclohexanamine
TRC-B125008-2.5G 2.5 g

N-Benzylcyclohexanamine

Sign In for Pricing
View Details
STAT1 pSer727 Rabbit Polyclonal Antibody
AP12715PU-N 400 µL

STAT1 pSer727 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details