Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calml4 Peptide - N-terminal region

Calml4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2010002G05Rik

UniProt

Q91WQ9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Calml4 Rabbit Polyclonal Antibody (orb586952) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612177

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YKECFSLYDKQQRGKIKATDLLVSMRCLGASPTPGEVQRHLQTHGIDKNG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

11-Oxo Androsterone-d4
TRC-O847112-10MG 10 mg

11-Oxo Androsterone-d4

Sign In for Pricing
View Details
GPR44 (PTGDR2) (N-term) Rabbit Polyclonal Antibody
AP22663PU-N 50 µg

GPR44 (PTGDR2) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2X Ampli-Optimization Kit, 150app
PLAO01 150 Apps

2X Ampli-Optimization Kit, 150app

Sign In for Pricing
View Details
Recombinant Nectin-2 Antibody
RC-3978-01 50 μL

Recombinant Nectin-2 Antibody

Sign In for Pricing
View Details
Recombinant Nectin-2 Antibody
RC-3978-02 100 µL

Recombinant Nectin-2 Antibody

Sign In for Pricing
View Details
Recombinant Nectin-2 Antibody
RC-3978-03 1 mL

Recombinant Nectin-2 Antibody

Sign In for Pricing
View Details