Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dcun1d2 Peptide - N-terminal region

Dcun1d2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AW495713, mFLJ10704

UniProt

G5E8Q5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dcun1d2 Rabbit Polyclonal Antibody (orb586977) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001036114

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MHKLKSAQKDKVRQFMACTQASERTAIYCLTQNEWKLDEATDSFFQNPEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-{1,4-Dioxaspiro[4.6]undecan-2-ylmethyl}guanidine hydroiodide
THC98132-01 50 mg

1-{1,4-Dioxaspiro[4.6]undecan-2-ylmethyl}guanidine hydroiodide

Sign In for Pricing
View Details
1-{1,4-Dioxaspiro[4.6]undecan-2-ylmethyl}guanidine hydroiodide
THC98132-02 0.5 g

1-{1,4-Dioxaspiro[4.6]undecan-2-ylmethyl}guanidine hydroiodide

Sign In for Pricing
View Details
Vrk1 (NM_001029844) Mouse Untagged Clone
MC207443 10 µg

Vrk1 (NM_001029844) Mouse Untagged Clone

Sign In for Pricing
View Details
PLV3-U6-GRIK2-shRNA2-Puro Plasmid
PVT75671 2 µg

PLV3-U6-GRIK2-shRNA2-Puro Plasmid

Sign In for Pricing
View Details
CCNB3, phosphorylated (T280) (CCNB3, CYCB3, G2/mitotic-specific cyclin-B3) (MaxLight 750) discontinued
033396-ML750 100 µL

CCNB3, phosphorylated (T280) (CCNB3, CYCB3, G2/mitotic-specific cyclin-B3) (MaxLight 750) discontinued

Sign In for Pricing
View Details
CD3
PP160-6ml 6 mL

CD3

Sign In for Pricing
View Details