Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dcun1d2 Peptide - N-terminal region

Dcun1d2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AW495713, mFLJ10704

UniProt

G5E8Q5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dcun1d2 Rabbit Polyclonal Antibody (orb586977) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001036114

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MHKLKSAQKDKVRQFMACTQASERTAIYCLTQNEWKLDEATDSFFQNPEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-NXPH3 Antibody
CPA5014-01 30 µL

Anti-NXPH3 Antibody

Sign In for Pricing
View Details
Anti-NXPH3 Antibody
CPA5014-02 50 μL

Anti-NXPH3 Antibody

Sign In for Pricing
View Details
Anti-NXPH3 Antibody
CPA5014-03 100 µL

Anti-NXPH3 Antibody

Sign In for Pricing
View Details
Anti-NXPH3 Antibody
CPA5014-04 200 µL

Anti-NXPH3 Antibody

Sign In for Pricing
View Details
Mboat7 3'UTR Lenti-reporter-Luc Vector
28183084 1.0 µg

Mboat7 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Phospho-HSPB1 (S15) Antibody
MBS7115749-01 0.05 mg

Phospho-HSPB1 (S15) Antibody

Sign In for Pricing
View Details