Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dcun1d2 Peptide - N-terminal region

Dcun1d2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AW495713, mFLJ10704

UniProt

G5E8Q5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dcun1d2 Rabbit Polyclonal Antibody (orb586977) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001036114

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MHKLKSAQKDKVRQFMACTQASERTAIYCLTQNEWKLDEATDSFFQNPEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat SerpinA1/A1AT protein (His tag)
PDMR100025-01 20 µg

Recombinant Rat SerpinA1/A1AT protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat SerpinA1/A1AT protein (His tag)
PDMR100025-02 100 µg

Recombinant Rat SerpinA1/A1AT protein (His tag)

Sign In for Pricing
View Details
Anti-Renin Receptor Rabbit pAb
GB112076 100 μL

Anti-Renin Receptor Rabbit pAb

Sign In for Pricing
View Details
NCKAP5 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-13693R-BF594 100 µL

NCKAP5 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal SPINK2 Antibody [DyLight 755]
NBP2-82015IR 0.1 mL

Rabbit Polyclonal SPINK2 Antibody [DyLight 755]

Sign In for Pricing
View Details
Ero1a (NM_015774) Mouse Recombinant Protein
E45M46214M5 20 µg

Ero1a (NM_015774) Mouse Recombinant Protein

Sign In for Pricing
View Details