Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fam107b Peptide - middle region

Fam107b Peptide - middle region

Product Specifications

UniProt

Q5U4F3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fam107b Rabbit Polyclonal Antibody (orb587001) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020205

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PELQKVMEKRRRDQVIKQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Vps26c Pre-designed siRNA Set B
SI115904B 1 Each

Mouse Vps26c Pre-designed siRNA Set B

Sign In for Pricing
View Details
Cinpanemab
abx831532-01 100 µg

Cinpanemab

Sign In for Pricing
View Details
Cinpanemab
abx831532-02 1 mg

Cinpanemab

Sign In for Pricing
View Details
AMACR Antibody
E51A10009 100 µL

AMACR Antibody

Sign In for Pricing
View Details
Goat soluble receptor activator ofnuclear factor-kB ligand (sRANKL) ELISA Kit
NSL0139Gt 96 Tests

Goat soluble receptor activator ofnuclear factor-kB ligand (sRANKL) ELISA Kit

Sign In for Pricing
View Details
Anti-TMED1 Antibody Picoband® APC Conjugated
A12148-1-APC 100 µg/Vial

Anti-TMED1 Antibody Picoband® APC Conjugated

Sign In for Pricing
View Details