Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fam107b Peptide - middle region

Fam107b Peptide - middle region

Product Specifications

UniProt

Q5U4F3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fam107b Rabbit Polyclonal Antibody (orb587001) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020205

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PELQKVMEKRRRDQVIKQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DIA2 Antibody
orb845578 2 mg

DIA2 Antibody

Sign In for Pricing
View Details
Iba1 (17Z18) Rabbit Monoclonal Antibody
E28M5617 100 µL

Iba1 (17Z18) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Disp2 (NM_170593) Mouse Tagged Lenti ORF Clone
MR222229L4 10 µg

Disp2 (NM_170593) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
DAZ1 antibody - N-terminal region (ARP58711_P050)
ARP58711_P050 100 µL

DAZ1 antibody - N-terminal region (ARP58711_P050)

Sign In for Pricing
View Details
Recombinant Human FBXO3 Protein - (Dry Ice)
H00026273-P01-25ug 25 µg

Recombinant Human FBXO3 Protein - (Dry Ice)

Sign In for Pricing
View Details
BSA Standard, 2mg/mL
22070006-2 100 mL

BSA Standard, 2mg/mL

Sign In for Pricing
View Details