Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fam110a Peptide - C-terminal region

Fam110a Peptide - C-terminal region

Product Specifications

Product Name Alternative

RGD1308904

UniProt

Q6AXZ9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fam110a Rabbit Polyclonal Antibody (orb587002) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001014072

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPGRPPGLQRSKSDLSERFSRAAADLERFFNFCGLDPEEARGLGVAHLAR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Interleukin 22 Receptor Alpha 2 (IL22Ra2) ELISA Kit
RD-IL22Ra2-Mu-01 96 Tests

Mouse Interleukin 22 Receptor Alpha 2 (IL22Ra2) ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 22 Receptor Alpha 2 (IL22Ra2) ELISA Kit
RD-IL22Ra2-Mu-02 48 Tests

Mouse Interleukin 22 Receptor Alpha 2 (IL22Ra2) ELISA Kit

Sign In for Pricing
View Details
Recombinant PI3 Kinase p110 alpha Antibody
RC-16789-01 50 μL

Recombinant PI3 Kinase p110 alpha Antibody

Sign In for Pricing
View Details
Recombinant PI3 Kinase p110 alpha Antibody
RC-16789-02 100 µL

Recombinant PI3 Kinase p110 alpha Antibody

Sign In for Pricing
View Details
Recombinant PI3 Kinase p110 alpha Antibody
RC-16789-03 1 mL

Recombinant PI3 Kinase p110 alpha Antibody

Sign In for Pricing
View Details
SKP2 Antibody
OC-2410-01 50 μL

SKP2 Antibody

Sign In for Pricing
View Details