Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fam110a Peptide - C-terminal region

Fam110a Peptide - C-terminal region

Product Specifications

Product Name Alternative

RGD1308904

UniProt

Q6AXZ9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fam110a Rabbit Polyclonal Antibody (orb587002) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001014072

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPGRPPGLQRSKSDLSERFSRAAADLERFFNFCGLDPEEARGLGVAHLAR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Snta1 Mouse Gene Knockout Kit (CRISPR)
KN316412BN 1 Kit

Snta1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Horseradish Peroxidase,  5nm
GM-503-5 1 mL

Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Horseradish Peroxidase, 5nm

Sign In for Pricing
View Details
Cyclosporin AM 4N Acetate
TRC-C989995-2.5MG 2.5 mg

Cyclosporin AM 4N Acetate

Sign In for Pricing
View Details
Benzydamine
TRC-B414053-50MG 50 mg

Benzydamine

Sign In for Pricing
View Details
Recombinant Human PUMA/BBC3 protein (His Tag)
PDEH100697-01 20 µg

Recombinant Human PUMA/BBC3 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human PUMA/BBC3 protein (His Tag)
PDEH100697-02 100 µg

Recombinant Human PUMA/BBC3 protein (His Tag)

Sign In for Pricing
View Details