Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CT47B1 Peptide - C-terminal region

CT47B1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CT47.13, CT47A13

UniProt

P0C2W7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CT47B1 Rabbit Polyclonal Antibody (orb587345) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001139190

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPEEAAEEKLTEEATEEPAAEEPTSEEAVAPEEVTKSQPEKWDEEAQDAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cystathionine-β-synthase (CBS) Activity Colorimetric Assay Kit
E-BC-K811-M-01 48 T (46 samples)

Cystathionine-β-synthase (CBS) Activity Colorimetric Assay Kit

Sign In for Pricing
View Details
Cystathionine-β-synthase (CBS) Activity Colorimetric Assay Kit
E-BC-K811-M-02 96 T (94 samples)

Cystathionine-β-synthase (CBS) Activity Colorimetric Assay Kit

Sign In for Pricing
View Details
Prm3 Mouse Gene Knockout Kit (CRISPR)
KN513932 1 Kit

Prm3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Anti-FGL1
Y158545 100 µL

Anti-FGL1

Sign In for Pricing
View Details
AP2 gamma (TFAP2C) Rabbit Polyclonal Antibody
AP01241PU-N 100 µg

AP2 gamma (TFAP2C) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Uncoated Rat GM-CSF (Granulocyte-Macrophage Colony Stimulating Factor) ELISA Kit
E-UNEL-R0069-01 5x 96 Tests

Uncoated Rat GM-CSF (Granulocyte-Macrophage Colony Stimulating Factor) ELISA Kit

Sign In for Pricing
View Details