Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CT47B1 Peptide - C-terminal region

CT47B1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CT47.13, CT47A13

UniProt

P0C2W7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CT47B1 Rabbit Polyclonal Antibody (orb587345) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001139190

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPEEAAEEKLTEEATEEPAAEEPTSEEAVAPEEVTKSQPEKWDEEAQDAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta-Muricholic Acid
TRC-M732755-1MG 1 mg

Beta-Muricholic Acid

Sign In for Pricing
View Details
Polystyrene A REM
HA110018.25G 25 g

Polystyrene A REM

Sign In for Pricing
View Details
PRMT4 (CARM1) (Center) Rabbit Polyclonal Antibody
AP53448PU-N 400 µL

PRMT4 (CARM1) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Flat Mat, extra large 14" x 12"
BR2000-FLAT 1 Each

Flat Mat, extra large 14" x 12"

Sign In for Pricing
View Details
Menthol-d4 (mixture of diastereomers)
TRC-M218902-25MG 25 mg

Menthol-d4 (mixture of diastereomers)

Sign In for Pricing
View Details
Human IMP3 activation kit by CRISPRa
GA110660 1 Kit

Human IMP3 activation kit by CRISPRa

Sign In for Pricing
View Details