Ppfia3 Peptide - C-terminal region
Ppfia3 Peptide - C-terminal region
Product Specifications
UniProt
F1LSE6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ppfia3 Rabbit Polyclonal Antibody (orb587036) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001257914
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ETFDYSDLALLLQIPTQNAQARQLLEKEFSNLISLGTDRRLDEDSAKSFS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TP762748 50 µg
p57 Kip2 (CDKN1C) (NM_000076) Human Recombinant Protein
Sign In for Pricing
View Details 
TRC-C367750-25MG 25 mg
4-(Chloromercuri)benzenesulfonic Acid Sodium Salt
Sign In for Pricing
View Details