Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ppfia3 Peptide - C-terminal region

Ppfia3 Peptide - C-terminal region

Product Specifications

UniProt

F1LSE6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ppfia3 Rabbit Polyclonal Antibody (orb587036) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001257914

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ETFDYSDLALLLQIPTQNAQARQLLEKEFSNLISLGTDRRLDEDSAKSFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem241 Mouse Gene Knockout Kit (CRISPR)
KN517827 1 Kit

Tmem241 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Digoxigenin Tyramide
TRC-D446511-5MG 5 mg

Digoxigenin Tyramide

Sign In for Pricing
View Details
Tex22 (NM_029381) Mouse Tagged ORF Clone
MG201792 10 µg

Tex22 (NM_029381) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Benzenesulfinic Acid Sodium Salt
TRC-B120600-250G 250 g

Benzenesulfinic Acid Sodium Salt

Sign In for Pricing
View Details
TACO1 (NM_016360) Human Over-expression Lysate
LC402545 20 µg

TACO1 (NM_016360) Human Over-expression Lysate

Sign In for Pricing
View Details
Human IL17REL activation kit by CRISPRa
GA118295 1 Kit

Human IL17REL activation kit by CRISPRa

Sign In for Pricing
View Details