Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Spcs2 Peptide - N-terminal region

Spcs2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RGD1311253

UniProt

D3ZD11

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Spcs2 Rabbit Polyclonal Antibody (orb587038) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001178530

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GTSSSRSGLLDKWKIDDKPVKIDKWDGSAVKNSLDDSAKKVLLEKYKYVE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-Phe (4-NH2) -OH
HY-W010982-01 5 g

Fmoc-Phe (4-NH2) -OH

Sign In for Pricing
View Details
Fmoc-Phe (4-NH2) -OH
HY-W010982-02 10 g

Fmoc-Phe (4-NH2) -OH

Sign In for Pricing
View Details
Fmoc-Phe (4-NH2) -OH
HY-W010982-03 25 g

Fmoc-Phe (4-NH2) -OH

Sign In for Pricing
View Details
C03C10.5 Antibody
orb802187 2 mg

C03C10.5 Antibody

Sign In for Pricing
View Details
Recombinant Human KRT16, N-His
MBS1573171-01 0.1 mg

Recombinant Human KRT16, N-His

Sign In for Pricing
View Details
Recombinant Human KRT16, N-His
MBS1573171-02 1 mg

Recombinant Human KRT16, N-His

Sign In for Pricing
View Details