Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tma16 Peptide - middle region

Tma16 Peptide - middle region

Product Specifications

Product Name Alternative

Tma16

UniProt

Q9CR02

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tma16 Rabbit Polyclonal Antibody (orb326784) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079741

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IGDKLQWFHSHLDMKKTRYSKKDACELVERYLDRFSSELEQIELQNSIKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant FAP Antibody
RC-6628-01 50 μL

Recombinant FAP Antibody

Sign In for Pricing
View Details
Recombinant FAP Antibody
RC-6628-02 100 µL

Recombinant FAP Antibody

Sign In for Pricing
View Details
Recombinant FAP Antibody
RC-6628-03 1 mL

Recombinant FAP Antibody

Sign In for Pricing
View Details
RNF19A Antibody
KC-2834-01 50 μL

RNF19A Antibody

Sign In for Pricing
View Details
RNF19A Antibody
KC-2834-02 100 µL

RNF19A Antibody

Sign In for Pricing
View Details
RNF19A Antibody
KC-2834-03 1 mL

RNF19A Antibody

Sign In for Pricing
View Details