Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tma16 Peptide - middle region

Tma16 Peptide - middle region

Product Specifications

Product Name Alternative

Tma16

UniProt

Q9CR02

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tma16 Rabbit Polyclonal Antibody (orb326784) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079741

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IGDKLQWFHSHLDMKKTRYSKKDACELVERYLDRFSSELEQIELQNSIKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,3,5-Tri-O-benzyl-D-ribofuranose
TRC-T771350-5G 5 g

2,3,5-Tri-O-benzyl-D-ribofuranose

Sign In for Pricing
View Details
NGF Human Gene Knockout Kit (CRISPR)
KN421463 1 Kit

NGF Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SNRPC (C-term) Rabbit Polyclonal Antibody
AP12499PU-N 400 µL

SNRPC (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse Ccl8 Protein (Trx Tag)
PDEM100131-01 20 µg

Recombinant Mouse Ccl8 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse Ccl8 Protein (Trx Tag)
PDEM100131-02 100 µg

Recombinant Mouse Ccl8 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse Ccl8 Protein (Trx Tag)
PDEM100131-03 500 µg

Recombinant Mouse Ccl8 Protein (Trx Tag)

Sign In for Pricing
View Details