Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ccdc47 Peptide - C-terminal region

Ccdc47 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2610204L23Rik, C88307, RP23-81G14.10, asp4, calumin

UniProt

Q9D024

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ccdc47 Rabbit Polyclonal Antibody (orb587100) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080285

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ADKNRARVEENFLKLTHVQRQEAAQSRREEKKRAEKERIMNEEDPEKQRR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

[Pro18, Asp21]-Beta-Amyloid (17-21)
MBS8227699-01 1 mg

[Pro18, Asp21]-Beta-Amyloid (17-21)

Sign In for Pricing
View Details
[Pro18, Asp21]-Beta-Amyloid (17-21)
MBS8227699-02 5 mg

[Pro18, Asp21]-Beta-Amyloid (17-21)

Sign In for Pricing
View Details
[Pro18, Asp21]-Beta-Amyloid (17-21)
MBS8227699-03 10 mg

[Pro18, Asp21]-Beta-Amyloid (17-21)

Sign In for Pricing
View Details
[Pro18, Asp21]-Beta-Amyloid (17-21)
MBS8227699-04 5x 10 mg

[Pro18, Asp21]-Beta-Amyloid (17-21)

Sign In for Pricing
View Details
PUB44 antibody
70R-33225 100 µL

PUB44 antibody

Sign In for Pricing
View Details
Recombinant Enterobacter sp. Biotin synthase (bioB)
MBS1103932-01 0.02 mg (E-Coli)

Recombinant Enterobacter sp. Biotin synthase (bioB)

Sign In for Pricing
View Details