Ccdc47 Peptide - C-terminal region
Ccdc47 Peptide - C-terminal region
Product Specifications
Product Name Alternative
2610204L23Rik, C88307, RP23-81G14.10, asp4, calumin
UniProt
Q9D024
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ccdc47 Rabbit Polyclonal Antibody (orb587100) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_080285
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ADKNRARVEENFLKLTHVQRQEAAQSRREEKKRAEKERIMNEEDPEKQRR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
250990-FITC 100 µL
RCN1 (reticulocalbin 1, EF-hand Calcium Binding Domain, FLJ37041, PIG20, RCAL, RCN) (FITC)
Sign In for Pricing
View Details 
A07827-2-Dylight488 100 µg
Anti-GPR50 Antibody Picoband® (Dylight488 Conjugate)
Sign In for Pricing
View Details 
orb2695484 10 mg
Palladium meso-tetra (pentafluorophenyl) porphyrin
Sign In for Pricing
View Details 
MBS6250708-01 0.1 mL
CD81 (TAPA-1, Target of anti-Proliferative Antibody-1) (HRP)
Sign In for Pricing
View Details