Pdzd4 Peptide - C-terminal region
Pdzd4 Peptide - C-terminal region
Product Specifications
Product Name Alternative
B230341P03, D130075J17Rik, Kiaa1444-hp, LU1, PDZRN4L, Pdzk4, Pdzrnk4l, Xlu
UniProt
Q9QY39
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Pdzd4 Rabbit Polyclonal Antibody (orb587102) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001025039
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SEMKMGRYWSKEERKQHLIRAREQRKRREFMMQSRLECLREQQNGDSKPE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PerCP Anti-Human CD15/SSEA-1 Antibody[HI98]](https://cdn.genprice.uk/products/763/68dd14a2061270361e7d0c53/imageurl/e-ab-f1079f.webp)
E-AB-F1079F-01 20 Tests
PerCP Anti-Human CD15/SSEA-1 Antibody[HI98]
Sign In for Pricing
View Details E-AB-F1079F-02 100 Tests
PerCP Anti-Human CD15/SSEA-1 Antibody[HI98]
Sign In for Pricing
View Details E-AB-F1079F-03 2x 100 Tests
PerCP Anti-Human CD15/SSEA-1 Antibody[HI98]
Sign In for Pricing
View Details 