Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pdzd4 Peptide - C-terminal region

Pdzd4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

B230341P03, D130075J17Rik, Kiaa1444-hp, LU1, PDZRN4L, Pdzk4, Pdzrnk4l, Xlu

UniProt

Q9QY39

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pdzd4 Rabbit Polyclonal Antibody (orb587102) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001025039

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SEMKMGRYWSKEERKQHLIRAREQRKRREFMMQSRLECLREQQNGDSKPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ECH1 (NM_001398) Human Over-expression Lysate
LY419959 100 µg

ECH1 (NM_001398) Human Over-expression Lysate

Sign In for Pricing
View Details
APC Anti-Mouse CD69 Antibody[H1.2F3]
E-AB-F1187E-01 50 Tests

APC Anti-Mouse CD69 Antibody[H1.2F3]

Sign In for Pricing
View Details
APC Anti-Mouse CD69 Antibody[H1.2F3]
E-AB-F1187E-02 100 Tests

APC Anti-Mouse CD69 Antibody[H1.2F3]

Sign In for Pricing
View Details
APC Anti-Mouse CD69 Antibody[H1.2F3]
E-AB-F1187E-03 2x 100 Tests

APC Anti-Mouse CD69 Antibody[H1.2F3]

Sign In for Pricing
View Details
ASAH3L (ACER2) Human Gene Knockout Kit (CRISPR)
KN417746 1 Kit

ASAH3L (ACER2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N-Phenyl 2-Bromo-5-Fluorobenzamide
TRC-P400985-500MG 500 mg

N-Phenyl 2-Bromo-5-Fluorobenzamide

Sign In for Pricing
View Details