Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cdk15 Peptide - N-terminal region

Cdk15 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Als2cr7, Pftk2

UniProt

Q3V3A1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cdk15 Rabbit Polyclonal Antibody (orb587112) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001028545

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ASFHPRGLEAASAQKLKSKRPRSNSDSFQEENLRQGLPWKKSLPFGAASS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium Difficile gcvH Protein (aa 1-125)
VAng-Lsx9165-1mgEcoli 1 mg (E. coli)

Recombinant Clostridium Difficile gcvH Protein (aa 1-125)

Sign In for Pricing
View Details
Pararosaniline acetate
GT3052-5g 5 g

Pararosaniline acetate

Sign In for Pricing
View Details
pCMV-Kdm5a-3×FLAG-Neo Plasmid
PVT51091 2 µg

pCMV-Kdm5a-3×FLAG-Neo Plasmid

Sign In for Pricing
View Details
ELAC1 Antibody
MBS1499742-01 0.05 mg

ELAC1 Antibody

Sign In for Pricing
View Details
ELAC1 Antibody
MBS1499742-02 0.1 mg

ELAC1 Antibody

Sign In for Pricing
View Details
ELAC1 Antibody
MBS1499742-03 5x 0.1 mg

ELAC1 Antibody

Sign In for Pricing
View Details