Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cdk15 Peptide - N-terminal region

Cdk15 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Als2cr7, Pftk2

UniProt

Q3V3A1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cdk15 Rabbit Polyclonal Antibody (orb587112) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001028545

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ASFHPRGLEAASAQKLKSKRPRSNSDSFQEENLRQGLPWKKSLPFGAASS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cytokeratin 14 (KRT14) (NM_000526) AAV Particle
RC214907A1V 250 µL

Human Cytokeratin 14 (KRT14) (NM_000526) AAV Particle

Sign In for Pricing
View Details
PHKB Protein Lysate
OCOA15911-20UG 20 µg

PHKB Protein Lysate

Sign In for Pricing
View Details
Biotinylated isoxazole (Standard)
HY-W750960R 1 Each

Biotinylated isoxazole (Standard)

Sign In for Pricing
View Details
OR1E1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1486806 1.0 µg DNA

OR1E1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
USP7/HAUSP polyclonal antibody
BS75377-01 50 µL

USP7/HAUSP polyclonal antibody

Sign In for Pricing
View Details
USP7/HAUSP polyclonal antibody
BS75377-02 100 µL

USP7/HAUSP polyclonal antibody

Sign In for Pricing
View Details