Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tigd5 Peptide - N-terminal region

Tigd5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AA409802, AA409995, AI666797

UniProt

Q499M4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tigd5 Rabbit Polyclonal Antibody (orb587167) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848761

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PGSTARPPPPPAPGPRPRVAVKMTFRKAYSIKDKLQAIERVKGGERQASV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human APC2 shRNA (UAS) - Lentiviral human APC2 shRNA (UAS, RFP) plasmid
GTR15289945 1 Vial

Lentiviral human APC2 shRNA (UAS) - Lentiviral human APC2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
CPNE8 Human shRNA Plasmid Kit (Locus ID 144402)
TR305241 1 Kit

CPNE8 Human shRNA Plasmid Kit (Locus ID 144402)

Sign In for Pricing
View Details
SVH (ARMC10) (NM_031905) Human Recombinant Protein
TP317510 20 µg

SVH (ARMC10) (NM_031905) Human Recombinant Protein

Sign In for Pricing
View Details
Human Hsp60  ELISA kit
55R-IB09639 96 wells

Human Hsp60 ELISA kit

Sign In for Pricing
View Details
Angiopoietin-2, Cynomolgus/Rhesus Macaque (HEK293, His)
HY-P76149-01 10 µg

Angiopoietin-2, Cynomolgus/Rhesus Macaque (HEK293, His)

Sign In for Pricing
View Details
Angiopoietin-2, Cynomolgus/Rhesus Macaque (HEK293, His)
HY-P76149-02 50 µg

Angiopoietin-2, Cynomolgus/Rhesus Macaque (HEK293, His)

Sign In for Pricing
View Details