Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tigd5 Peptide - N-terminal region

Tigd5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AA409802, AA409995, AI666797

UniProt

Q499M4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tigd5 Rabbit Polyclonal Antibody (orb587167) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848761

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PGSTARPPPPPAPGPRPRVAVKMTFRKAYSIKDKLQAIERVKGGERQASV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal POLR2G Antibody
NBP2-95215-0.1mL 0.1 mL

Rabbit Polyclonal POLR2G Antibody

Sign In for Pricing
View Details
Mouse Olfactory receptor 8B2 (OR8B2) ELISA Kit
GTR10334199 96 Well

Mouse Olfactory receptor 8B2 (OR8B2) ELISA Kit

Sign In for Pricing
View Details
ENG Capture Antibody
OAOA21634-100UG 100 µg

ENG Capture Antibody

Sign In for Pricing
View Details
Anti-CD146/MCAM Antibody (APC), Mouse Monoclonal
MBS8101029-01 25 Tests

Anti-CD146/MCAM Antibody (APC), Mouse Monoclonal

Sign In for Pricing
View Details
Anti-CD146/MCAM Antibody (APC), Mouse Monoclonal
MBS8101029-02 100 Tests

Anti-CD146/MCAM Antibody (APC), Mouse Monoclonal

Sign In for Pricing
View Details
Anti-CD146/MCAM Antibody (APC), Mouse Monoclonal
MBS8101029-03 5x 100 Tests

Anti-CD146/MCAM Antibody (APC), Mouse Monoclonal

Sign In for Pricing
View Details