Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC103 Peptide - C-terminal region

CCDC103 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CILD17, PR46b, SMH

UniProt

Q8IW40

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC103 Rabbit Polyclonal Antibody (orb326925) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_998772

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RAAVLGILCSLASTGRFTLNLSLLSRAERESCKGLFQKLQAMGNPRSVKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFYVE1 (Zinc Finger FYVE Domain-Containing Protein 1, Double FYVE-Containing Protein 1, SR3, Tandem FYVE Fingers-1, DFCP1, KIAA1589, TAFF1, ZNFN2A1, PP10436)
407335-01 50 µL

ZFYVE1 (Zinc Finger FYVE Domain-Containing Protein 1, Double FYVE-Containing Protein 1, SR3, Tandem FYVE Fingers-1, DFCP1, KIAA1589, TAFF1, ZNFN2A1, PP10436)

Sign In for Pricing
View Details
ZFYVE1 (Zinc Finger FYVE Domain-Containing Protein 1, Double FYVE-Containing Protein 1, SR3, Tandem FYVE Fingers-1, DFCP1, KIAA1589, TAFF1, ZNFN2A1, PP10436)
407335-02 100 µL

ZFYVE1 (Zinc Finger FYVE Domain-Containing Protein 1, Double FYVE-Containing Protein 1, SR3, Tandem FYVE Fingers-1, DFCP1, KIAA1589, TAFF1, ZNFN2A1, PP10436)

Sign In for Pricing
View Details
10X PBS Buffer (100mM), pH=7.4
WB0028-20 20 L

10X PBS Buffer (100mM), pH=7.4

Sign In for Pricing
View Details
SCAMP1 Antibody
MBS9510170-01 0.05 mL

SCAMP1 Antibody

Sign In for Pricing
View Details
SCAMP1 Antibody
MBS9510170-02 0.1 mL

SCAMP1 Antibody

Sign In for Pricing
View Details
SCAMP1 Antibody
MBS9510170-03 5x 0.1 mL

SCAMP1 Antibody

Sign In for Pricing
View Details