Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INKA1 Peptide - middle region

INKA1 Peptide - middle region

Product Specifications

Product Name Alternative

C3orf54, FAM212A

UniProt

Q96EL1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with INKA1 Rabbit Polyclonal Antibody (orb326927) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_976248

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RAPVASVPPVHHPRPKSTPDACLEHWQGLEAEDWTAALLNRGRSRQPLVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal PRMT5 Antibody (OTI2H3) [Alexa Fluor 532]
NBP2-73604AF532 0.1 mL

Mouse Monoclonal PRMT5 Antibody (OTI2H3) [Alexa Fluor 532]

Sign In for Pricing
View Details
2-Propyl-1-heptanol 98%
P27490-01 1 g

2-Propyl-1-heptanol 98%

Sign In for Pricing
View Details
2-Propyl-1-heptanol 98%
P27490-02 5 g

2-Propyl-1-heptanol 98%

Sign In for Pricing
View Details
PKA RIIα (PRKAR2A) Rabbit mAb
A3889-01 20 µL

PKA RIIα (PRKAR2A) Rabbit mAb

Sign In for Pricing
View Details
PKA RIIα (PRKAR2A) Rabbit mAb
A3889-02 100 μL

PKA RIIα (PRKAR2A) Rabbit mAb

Sign In for Pricing
View Details
PKA RIIα (PRKAR2A) Rabbit mAb
A3889-03 500 μL

PKA RIIα (PRKAR2A) Rabbit mAb

Sign In for Pricing
View Details