INKA1 Peptide - middle region
INKA1 Peptide - middle region
Product Specifications
Product Name Alternative
C3orf54, FAM212A
UniProt
Q96EL1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with INKA1 Rabbit Polyclonal Antibody (orb326927) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_976248
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RAPVASVPPVHHPRPKSTPDACLEHWQGLEAEDWTAALLNRGRSRQPLVL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
156947-01 10 µg
T-Cell Immunoreceptor With Ig And ITIM Domains Protein (TIGIT) Recombinant, Human
Sign In for Pricing
View Details 156947-02 50 µg
T-Cell Immunoreceptor With Ig And ITIM Domains Protein (TIGIT) Recombinant, Human
Sign In for Pricing
View Details 156947-03 200 µg
T-Cell Immunoreceptor With Ig And ITIM Domains Protein (TIGIT) Recombinant, Human
Sign In for Pricing
View Details 
A13431-HRP 100 µg/Vial
Anti-TM9SF2 Antibody Picoband®, HRP Conjugate
Sign In for Pricing
View Details 