ARL13A Peptide - middle region
ARL13A Peptide - middle region
Product Specifications
Product Name Alternative
ARL13, dJ341D10.2
UniProt
Q5H913
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ARL13A Rabbit Polyclonal Antibody (orb326934) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001013008
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LTHLLSDKRVAGKPILILANKQDKKKALMPCDIIDYLLLKKLVKENKCPC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
36451154 3x 1.0 µg DNA
PFN2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
Sign In for Pricing
View Details