Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL13A Peptide - middle region

ARL13A Peptide - middle region

Product Specifications

Product Name Alternative

ARL13, dJ341D10.2

UniProt

Q5H913

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARL13A Rabbit Polyclonal Antibody (orb326934) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001013008

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTHLLSDKRVAGKPILILANKQDKKKALMPCDIIDYLLLKKLVKENKCPC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Mir1839 qPCR Primer Pair
QM79294S 200 Tests

Mouse Mir1839 qPCR Primer Pair

Sign In for Pricing
View Details
ISG20L2 Protein Vector (Rat) (pPM-C-HA)
PV275076 500 ng

ISG20L2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Phosphatidylinositol-4,5-bisphosphate 3-Kinase catalytic subunit α isoform (PIK3CA) Human ELISA Kit
F8402 96 Tests

Phosphatidylinositol-4,5-bisphosphate 3-Kinase catalytic subunit α isoform (PIK3CA) Human ELISA Kit

Sign In for Pricing
View Details
Anti-HSPA2 Antibody Picoband®, APC Conjugate
PA1814-APC 100 µg/Vial

Anti-HSPA2 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
Recombinant Human ABHD8 Protein - (Dry Ice)
H00079575-P01-2ug 2 µg

Recombinant Human ABHD8 Protein - (Dry Ice)

Sign In for Pricing
View Details
TPO (Thyroid Peroxidase) (Thyroid Marker) Mouse Monoclonal Antibody [Clone TPO/3701]
MBS4382278-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

TPO (Thyroid Peroxidase) (Thyroid Marker) Mouse Monoclonal Antibody [Clone TPO/3701]

Sign In for Pricing
View Details