Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL13A Peptide - middle region

ARL13A Peptide - middle region

Product Specifications

Product Name Alternative

ARL13, dJ341D10.2

UniProt

Q5H913

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARL13A Rabbit Polyclonal Antibody (orb326934) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001013008

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTHLLSDKRVAGKPILILANKQDKKKALMPCDIIDYLLLKKLVKENKCPC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC23 Human shRNA Lentiviral Particle (Locus ID 10233)
TL303468V 500 µL Each

LRRC23 Human shRNA Lentiviral Particle (Locus ID 10233)

Sign In for Pricing
View Details
Rad2/FEN1 (Phospho-Ser187) rabbit pAb
UB-GEN-10331 100 µL

Rad2/FEN1 (Phospho-Ser187) rabbit pAb

Sign In for Pricing
View Details
Zinc finger MIZ domain containing protein 1 (ZMIZ1) (NM_020338) Human Tagged ORF Clone
RC222340 10 µg

Zinc finger MIZ domain containing protein 1 (ZMIZ1) (NM_020338) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) MET31 Polyclonal Antibody
MBS7150459 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) MET31 Polyclonal Antibody

Sign In for Pricing
View Details
SHARPIN Rabbit pAb (APR18603N)
APR18603N-01 50 µL

SHARPIN Rabbit pAb (APR18603N)

Sign In for Pricing
View Details
SHARPIN Rabbit pAb (APR18603N)
APR18603N-02 100 µL

SHARPIN Rabbit pAb (APR18603N)

Sign In for Pricing
View Details