ARL13A Peptide - middle region
ARL13A Peptide - middle region
Product Specifications
Product Name Alternative
ARL13, dJ341D10.2
UniProt
Q5H913
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ARL13A Rabbit Polyclonal Antibody (orb326934) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001013008
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LTHLLSDKRVAGKPILILANKQDKKKALMPCDIIDYLLLKKLVKENKCPC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
NBP2-14085 0.1 mL
Rabbit Polyclonal Histone Deacetylase 8/HDAC8 Antibody
Sign In for Pricing
View Details CF803054 100 µg
Melanoma gp100 (PMEL) Mouse Monoclonal Antibody [Clone ID: OTI1E5]
Sign In for Pricing
View Details 
K6181502 1.0 µg DNA
Sept12 sgRNA CRISPR Lentivector (Rat) (Target 1)
Sign In for Pricing
View Details MBS6304256-01 0.1 mL
GRAP2, ID (GRAP2, GADS, GRB2L, GRID, GRB2-related adapter protein 2, Adapter protein GRID, GRB-2-like protein, GRBLG, GRBX, Grf40 adapter protein, Growth factor receptor-binding protein, Hematopoietic cell-associated adapter protein GrpL, P38, Protein GAD
Sign In for Pricing
View Details MBS6304256-02 5x 0.1 mL
GRAP2, ID (GRAP2, GADS, GRB2L, GRID, GRB2-related adapter protein 2, Adapter protein GRID, GRB-2-like protein, GRBLG, GRBX, Grf40 adapter protein, Growth factor receptor-binding protein, Hematopoietic cell-associated adapter protein GrpL, P38, Protein GAD
Sign In for Pricing
View Details