C17orf102 Peptide - middle region
C17orf102 Peptide - middle region
Product Specifications
UniProt
A2RUQ5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C17orf102 Rabbit Polyclonal Antibody (orb326939) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_997337
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FCSRSSRGAGRGHPTPTPRVRWALAGNQPRCCAQLLSGRGGSGAQLRAGW
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470304-100 1x 100 µL
CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741073-100 1x 100 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881073-100 1x 100 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402207-500 1x 500 µL
HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (rGROEL/780), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881953-500 1x 500 µL
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1953), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details