Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNOT10 Peptide - C-terminal region

CNOT10 Peptide - C-terminal region

Product Specifications

UniProt

F8WAF2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CNOT10 Rabbit Polyclonal Antibody (orb326956) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001243671

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AMESSGKRAPQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Dystrophin-related protein 2, DRP2 ELISA Kit
MBS9337472-01 48 Well

Rat Dystrophin-related protein 2, DRP2 ELISA Kit

Sign In for Pricing
View Details
Rat Dystrophin-related protein 2, DRP2 ELISA Kit
MBS9337472-02 96 Well

Rat Dystrophin-related protein 2, DRP2 ELISA Kit

Sign In for Pricing
View Details
Rat Dystrophin-related protein 2, DRP2 ELISA Kit
MBS9337472-03 5x 96 Well

Rat Dystrophin-related protein 2, DRP2 ELISA Kit

Sign In for Pricing
View Details
Rat Dystrophin-related protein 2, DRP2 ELISA Kit
MBS9337472-04 10x 96 Well

Rat Dystrophin-related protein 2, DRP2 ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Killer cell immunoglobulin-like receptor 2DS5 (KIR2DS5), partial
MBS1453876-01 0.5 mg (E-Coli)

Recombinant Human Killer cell immunoglobulin-like receptor 2DS5 (KIR2DS5), partial

Sign In for Pricing
View Details
Recombinant Human Killer cell immunoglobulin-like receptor 2DS5 (KIR2DS5), partial
MBS1453876-02 0.05 mg (Baculovirus)

Recombinant Human Killer cell immunoglobulin-like receptor 2DS5 (KIR2DS5), partial

Sign In for Pricing
View Details